PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005489-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 270aa    MW: 30542.4 Da    PI: 6.6603
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005489-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-161165148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.......TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.......kgRtlkqcksrwqkyl 48
                     +g+WT++Ed++lv+ v ++G ++W+ Ia+  g       ++Rt+k+c++rw +yl
    NNU_005489-RA 11 KGPWTEQEDLQLVCFVGLFGERRWDFIAKVSGwkvagdsLNRTGKSCRLRWINYL 65
                     79***************************************************97 PP

2Myb_DNA-binding52.11.5e-1671116148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
    NNU_005489-RA  71 RGRLTPQEERLVLELHSLWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 116
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.892665IPR017930Myb domain
SuperFamilySSF466892.79E-279112IPR009057Homeodomain-like
SMARTSM007175.8E-151067IPR001005SANT/Myb domain
PfamPF002496.9E-151165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-181272IPR009057Homeodomain-like
CDDcd001674.01E-101365No hitNo description
PROSITE profilePS5129426.53966120IPR017930Myb domain
SMARTSM007171.1E-1570118IPR001005SANT/Myb domain
PfamPF002491.4E-1471115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2373119IPR009057Homeodomain-like
CDDcd001675.89E-1175116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVIMVQEEVR KGPWTEQEDL QLVCFVGLFG ERRWDFIAKV SGWKVAGDSL NRTGKSCRLR  60
WINYLHPGLK RGRLTPQEER LVLELHSLWG NRWSRIARKL PGRTDNEIKN YWRTHMRKKA  120
QERRRSSSPS SSSSQLCSSP STNNIKPPPV SLPEAAQNTT GDGEGWLQDY GASGDLAVQT  180
REMKEEGGHA LIGIGYPMDQ IWKEIASLEE VNSSEIVVSE GCSNDQGYSS YCSSVVTSPL  240
WDYCCSDTLW KIDEEDVKML LPASGMHDKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2681201105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253302.10.0PREDICTED: myb-related protein MYBAS1
SwissprotQ53NK65e-79MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLF6GV451e-87F6GV45_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g04140.t014e-87(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.33e-69myb domain protein 59